Protein Info for Sama_0183 in Shewanella amazonensis SB2B

Name: nudE
Annotation: ADP-ribose diphosphatase NudE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 47 to 169 (123 residues), 61.4 bits, E=4.7e-21

Best Hits

Swiss-Prot: 61% identical to NUDE_ECOLI: ADP compounds hydrolase NudE (nudE) from Escherichia coli (strain K12)

KEGG orthology group: K08312, ADP-ribose diphosphatase [EC: 3.6.1.-] (inferred from 100% identity to saz:Sama_0183)

MetaCyc: 61% identical to ADP-sugar diphosphatase NudE (Escherichia coli K-12 substr. MG1655)
ADP-sugar diphosphatase. [EC: 3.6.1.21]

Predicted SEED Role

"ADP compounds hydrolase NudE (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Fructose and mannose metabolism
• Lipopolysaccharide biosynthesis
• Purine metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.21

Sequence Analysis Tools

See A1S1Y8 at UniProt or InterPro

Protein Sequence (183 amino acids)

>Sama_0183 ADP-ribose diphosphatase NudE (RefSeq) (Shewanella amazonensis SB2B)
MGERRQKPEILHTEVVAKSRLFQIEQVHLRFANQVERYYERMKGSNRGAVMVVPVLGEQL
LLAREYAAGTDNYELGFPKGLVDPGELPAEAANRELQEEIGFGAHKLTLLKELSLAPGYF
SSKMQIFLAEDLYESRLEGDEPEPIEVVPWPLVDWQQLLELDDFSESRSVSALFLAQKHL
HLK