Protein Info for Sama_0150 in Shewanella amazonensis SB2B

Annotation: putative SAM-dependent methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF13489: Methyltransf_23" amino acids 42 to 160 (119 residues), 33.7 bits, see alignment E=9e-12 PF01209: Ubie_methyltran" amino acids 46 to 165 (120 residues), 21.7 bits, see alignment E=3.6e-08 PF13847: Methyltransf_31" amino acids 51 to 163 (113 residues), 32.9 bits, see alignment E=1.6e-11 PF13649: Methyltransf_25" amino acids 53 to 153 (101 residues), 46.3 bits, see alignment E=1.8e-15 PF08242: Methyltransf_12" amino acids 53 to 155 (103 residues), 43.5 bits, see alignment E=1.3e-14 PF08241: Methyltransf_11" amino acids 54 to 157 (104 residues), 49.3 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0150)

Predicted SEED Role

"FIG01058185: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1V6 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Sama_0150 putative SAM-dependent methyltransferase (RefSeq) (Shewanella amazonensis SB2B)
MDDFLTINQHAWDNRTELHLESDFYDMPGFMAGNTSLREIELAELDVRGKSLLHLQCHFG
QDTLSWAREGAASVTGLDLSPKAIAAATQIADTLDIEAKLGVPVQFVCGNVLDARNLVEG
DFDLVYASYGVLCWLPDLTVWANTIASCLKPGGYFYLAEFHPIKALLDGYDYFYTGKADV
EQEGSYTENSRDAENTMVSWSHDLGQVVSALINAGLVIESLREYDFSPYNCFENLEEEEP
GRFRQRIDGKPIPLVFSIKARKP