Protein Info for Sama_0141 in Shewanella amazonensis SB2B

Annotation: ferritin (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF00210: Ferritin" amino acids 7 to 143 (137 residues), 144.5 bits, see alignment E=1.1e-46

Best Hits

Swiss-Prot: 65% identical to FTN1_HAEIN: Probable bacterial non-heme ferritin (ftnA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02217, ferritin [EC: 1.16.3.1] (inferred from 100% identity to saz:Sama_0141)

MetaCyc: 63% identical to ferritin iron storage protein (Escherichia coli K-12 substr. MG1655)
RXN-15294 [EC: 1.16.3.2]

Predicted SEED Role

"Ferritin-like protein 2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.16.3.1

Use Curated BLAST to search for 1.16.3.1 or 1.16.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1U7 at UniProt or InterPro

Protein Sequence (175 amino acids)

>Sama_0141 ferritin (RefSeq) (Shewanella amazonensis SB2B)
MLAATMIEKLNEQINLEFFSSNLYLQMSAWCEDKGFEGAAHFMRAHADEEMGHMRRLFTY
VSETGGVPLIGAIAAPKAEFTSLLSLFEYTYEHEQTITRKINELAHVAFSTQDYSTFHFL
QWYVAEQHEEEKLFKSIVDKIRLVGEDGKALFFIDKDLAMLATQEAESIMKPSAQ