Protein Info for Sama_0133 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details PF02361: CbiQ" amino acids 90 to 209 (120 residues), 25.3 bits, see alignment E=5.7e-10

Best Hits

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 100% identity to saz:Sama_0133)

Predicted SEED Role

"Transmembrane component Dace_2068 of energizing module of predicted ECF transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1T9 at UniProt or InterPro

Protein Sequence (223 amino acids)

>Sama_0133 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MRLLSPTSRRARKPLVVDGRCGLAILGTLGMSMLALMSPPVWLWLPGLAGLAMAIDGSRF
ASPRPLVLLFVWQWLLTSALYGLFWGSERLGEAAWVALRLLLAFLPPWYLAIRFAPERLG
AFFANWLSPRWAFVLSASLNALPFVLTEAREIYRLQRLRGARIGAKDLINPLNWRELVHT
VISPLLIELLKLSRRQALAAKSRGFGQSANPSHWPHRGKQYED