Protein Info for Sama_0116 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details PF00892: EamA" amino acids 5 to 135 (131 residues), 64.2 bits, see alignment E=7.9e-22 amino acids 156 to 294 (139 residues), 64.4 bits, see alignment E=6.8e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0116)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1S2 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Sama_0116 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MSFEYLALLAAACWAVGSLMSATAATHLGAFAFTRIRMLSASVMLWLLALFVGSWHSLTL
DSLYLLALSGLIGIFIGDTALFAAMNRLGPRRAGVLFATHSLFSAVLAYLFLGETLWGWT
LFGSSLLISGVMVAIFFGKRKNEEHAWENGNLQVKRGMALALLSALCQAVSTLMLKPLME
TDIDAVAASAVRMSTAFVLHFALLLLGFSVAKAKTPATPKVLALTIGNAALSMVLGMTLI
LQALKHGNAGLVAILSSVSPILVLPLLWLVYRKSPAAGAWLGAIMTVAGTVLILAH