Protein Info for Sama_0080 in Shewanella amazonensis SB2B

Annotation: imidazolonepropionase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 TIGR01224: imidazolonepropionase" amino acids 27 to 408 (382 residues), 478.5 bits, see alignment E=6.5e-148 PF01979: Amidohydro_1" amino acids 65 to 391 (327 residues), 57.4 bits, see alignment E=1.6e-19 PF07969: Amidohydro_3" amino acids 114 to 386 (273 residues), 53.2 bits, see alignment E=3.7e-18

Best Hits

Swiss-Prot: 100% identical to HUTI_SHEAM: Imidazolonepropionase (hutI) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 100% identity to saz:Sama_0080)

MetaCyc: 58% identical to imidazolonepropionase (Pseudomonas fluorescens)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1N6 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Sama_0080 imidazolonepropionase (RefSeq) (Shewanella amazonensis SB2B)
MSWDQVWIDINIATMDPSMNEAYGAITDAALAVKDGKIAWLGKRSDLPEFDVLATPVHRG
HGGWLTPGLIDAHTHLVFAGNRANEFELRLQGASYEEIARAGGGIVSTVKACRDADEAEL
FDLARRRLNALAKEGVTTVEIKSGYGLDLDTELKLLRVARELGQHHHVDVVTTFLGAHAV
PPEFKTLGEAGTDAYVDLVVNEMLPAVVAENLADAADVFCENIAFNLEQTERVLSAAKTL
GLDIKLHAEQLSNLGGSELAARLGAKSVDHIEYLDEAGVKAIAQSGTCAVLLPGAFYFLR
ETKLPPIDLLRQYQVPMVLASDFNPGSSPICSTLLMLNMGCTLFRLTPEEALAGVTRNAA
RALGRDQRVGVLREGMEADFCLWRISTPAELAYSYGVNPLVDVVKGGRLIHQ