Protein Info for Sama_0077 in Shewanella amazonensis SB2B

Annotation: MerR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 PF13411: MerR_1" amino acids 4 to 64 (61 residues), 59.6 bits, see alignment E=1.2e-19 PF00376: MerR" amino acids 4 to 40 (37 residues), 47.3 bits, see alignment 6.5e-16 PF13489: Methyltransf_23" amino acids 172 to 329 (158 residues), 30.1 bits, see alignment E=1.7e-10 PF05175: MTS" amino acids 185 to 236 (52 residues), 23.7 bits, see alignment 1.5e-08 PF13847: Methyltransf_31" amino acids 186 to 309 (124 residues), 46.9 bits, see alignment E=1.2e-15 PF13649: Methyltransf_25" amino acids 188 to 282 (95 residues), 58.9 bits, see alignment E=3e-19 PF08241: Methyltransf_11" amino acids 189 to 286 (98 residues), 56.1 bits, see alignment E=2.1e-18 PF08242: Methyltransf_12" amino acids 189 to 284 (96 residues), 38.2 bits, see alignment E=9.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0077)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1N3 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Sama_0077 MerR family transcriptional regulator (RefSeq) (Shewanella amazonensis SB2B)
MTLRISQLAQKFGLSRSTLLYYEKQGLIRGRRLDNGYRVYSENDLQRLILIQKLQAGGLT
LKECLACLDARIDKALLQTRLAELDADIAQKQASRTLLAALLGEGDLKAWHESLTKEAPE
AHLDWLQTQGFSEKEALHLTWLSKDMNEHDKFMADFMQIFSPLTRWAPGSEADTLKALAS
VPLTPTRILDIGCGKGLATRMLAKHTKASITAIDNEEDALTELQQHLQHRNLASRVSTLC
ASMTDIPLPAASADLIWAEGSAYIMGVEQALKSWRKLLVDNGVLVLSDLVWLTDDKAPEA
VAFWQQDYPAMTSVEARMAQMQAAGFEVIDSFSLSNEAWKSFTGPLAARVDEVSEQLAGS
QALANVQRELGIFSRFLGQFGYQFFVLQKRG