Protein Info for Sama_0058 in Shewanella amazonensis SB2B

Annotation: C-terminal processing peptidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF22694: CtpB_N-like" amino acids 43 to 81 (39 residues), 37 bits, see alignment 7.7e-13 TIGR00225: C-terminal processing peptidase" amino acids 52 to 366 (315 residues), 301.6 bits, see alignment E=3.2e-94 PF00595: PDZ" amino acids 98 to 154 (57 residues), 24.7 bits, see alignment E=5e-09 PF17820: PDZ_6" amino acids 118 to 152 (35 residues), 31.7 bits, see alignment 2.1e-11 PF03572: Peptidase_S41" amino acids 197 to 358 (162 residues), 184.3 bits, see alignment E=2.7e-58

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 100% identity to saz:Sama_0058)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1L4 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Sama_0058 C-terminal processing peptidase (RefSeq) (Shewanella amazonensis SB2B)
MKQFIRYLGATVFGLALGISVSLSGQENARSVLSQYDYPLLVDIMDTIETYYVNQISRDE
LIEGAIEGMFKKLDPYSGYLSHQDLINIRDTNRGEYFGYGFEIASDDNLIRIVSPFSDSP
ADKAGIIAGDTIIAVNSHQVADMDLNAVLAEIRYHSLNNLPLTLTLEHSDKISYQVTLRP
ATISVASVQGRWLEGEIAYVRLTSFQDNTTEDLVKQLSQWNSPKGLILDLRNNPGGLLDQ
AIRIADLFLAKGRIVSTSGRYFDANSDYFASPQTLMTNVPMMVLINKGSASASEVLAAAL
QENGRALLIGETSFGKGTVQSLIPTLNMDSAIKLTIAHYNTPKGHDIHAKGIEPDIKIAA
QNTVKDAGDMPIIGSEQRKTQLEDQTLASAIAWIENQK