Protein Info for Sama_0054 in Shewanella amazonensis SB2B

Annotation: carbonic anhydrase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF14602: Hexapep_2" amino acids 80 to 112 (33 residues), 21 bits, see alignment 2.2e-08 amino acids 99 to 129 (31 residues), 16.8 bits, see alignment 4.8e-07 PF00132: Hexapep" amino acids 97 to 130 (34 residues), 29.5 bits, see alignment 4.2e-11

Best Hits

Swiss-Prot: 59% identical to YRDA_SHIFL: Protein YrdA (yrdA) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0054)

Predicted SEED Role

"carbonic anhydrase, family 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1L0 at UniProt or InterPro

Protein Sequence (182 amino acids)

>Sama_0054 carbonic anhydrase (RefSeq) (Shewanella amazonensis SB2B)
MSKALRSYKGMAPKLGANVYIDEACVLVGDIELGDDASVWPMVAARGDVNHIRIGKRSSI
QDGTILHVTRKTPAKPEGHPLIIGDDVTVGHKAMLHGCTVGNRVLIGMGAIVLDGAHVCD
DVILGAGSLVPPGKVLESGYLYVGSPAKQARPLTEAELKFLPQSAQNYVLLKEEYLQEQA
SA