Protein Info for Sama_0052 in Shewanella amazonensis SB2B

Annotation: shikimate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR00507: shikimate dehydrogenase" amino acids 10 to 274 (265 residues), 275.9 bits, see alignment E=1.4e-86 PF08501: Shikimate_dh_N" amino acids 12 to 94 (83 residues), 92.8 bits, see alignment E=1.9e-30 PF01488: Shikimate_DH" amino acids 122 to 195 (74 residues), 41.6 bits, see alignment E=2e-14 PF18317: SDH_C" amino acids 241 to 271 (31 residues), 34.1 bits, see alignment 2.7e-12

Best Hits

Swiss-Prot: 100% identical to AROE_SHEAM: Shikimate dehydrogenase (NADP(+)) (aroE) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 100% identity to saz:Sama_0052)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1K8 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Sama_0052 shikimate dehydrogenase (RefSeq) (Shewanella amazonensis SB2B)
MICLSMTDRFAVFGNPISHSKSPQIHAMFAKETGQTLTYEAILAPLDGFAEAVTAFMAAG
GCGANVTVPFKEQAFTLCDELSDDARIAGAVNTLIKLPDGRLRGDNTDGMGLVADLIRHG
VELNNKRVLLVGAGGAARGALLPLVRAGAKLTISNRTLSKAEALAALCPKVNVEVISGSH
IRSPFDVIINSTSASLSGDLPVIAANAIDNQTVCYDMMYGAKPTVFNEWARSLGAKICID
GLGMLVGQAAESFYLWRRVRPNAAPVLQTLRQSLISGV