Protein Info for Sama_0039 in Shewanella amazonensis SB2B

Annotation: potassium uptake protein TrkH (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 326 to 351 (26 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details amino acids 453 to 473 (21 residues), see Phobius details PF02386: TrkH" amino acids 40 to 479 (440 residues), 210.8 bits, see alignment E=1.6e-66 TIGR00933: potassium uptake protein, TrkH family" amino acids 85 to 463 (379 residues), 348 bits, see alignment E=3.8e-108

Best Hits

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 100% identity to saz:Sama_0039)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1J5 at UniProt or InterPro

Protein Sequence (480 amino acids)

>Sama_0039 potassium uptake protein TrkH (RefSeq) (Shewanella amazonensis SB2B)
MLNLRPLLFILGTFLSMLAGFMLIPLLFALLHGDETSGAFMISSLATGAAASFCISSGQQ
KNIKLNIRDMFLLTSITWLVVSLFAAMPFTLYHGINYTDAFFETMSGITTTGSTVLSGLD
SMDRSILIWRSLLQWLGGIGFIVMAVAVLPFLNVGGMRLFRTESSDWSDKSTPRTQDMAK
NLFLVYILLTILCGLGYHLAGMDWFEAINHAMTTLSTGGYSTSDESMAHFSPAAHWVGTS
FMLAGGLPLLIFVQMLRGRSLTVWNDAQVKGFLLFVALVSVALSFWLADVKDLAFMDALR
LTSFNVVSVVTTTGYGLTDYGSWGPLANVAFLFLMFVGACSGSTSGGIKIFRFQIAGAIM
REQLKQQIHPAGIFRERYNNRPISEDIIRSLVTFILLFMGVTVALAVFLVAVGVDPMSSL
TGAITAVTNVGPGLGPVIGPAGNFASLPDSAKWALSLGMLLGRLEILTVAVLFHPKFWHY