Protein Info for Sama_0019 in Shewanella amazonensis SB2B

Annotation: putative transmembrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 218 to 251 (34 residues), see Phobius details amino acids 265 to 293 (29 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details PF06166: DUF979" amino acids 9 to 326 (318 residues), 408.5 bits, see alignment E=9.1e-127

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0019)

Predicted SEED Role

"FIG001614: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1H5 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Sama_0019 putative transmembrane protein (RefSeq) (Shewanella amazonensis SB2B)
MSLISIKDIYLLIGLVVAILVVLTLRDKQHPKRFTTALFWGLFGSLFLFGDLAVNTLGAK
LAHQIAGAMVIGIALLAGMGRVSLGSYQETTPAQKEHSAKQLGNQLFLPALLIPLLTVAA
TLLLAGVNFGDVLLLDPKHQTLAALALACSIALLLGWRLTGDSPLKAVAESRRLVDSIGW
AAILPQMLAMLGGVFVVAQTGDSIKALVSLFIDPSNRFGLVVIYCVGMALFTMIMGNAFA
AFPVMTAGIALPFLIEGQGASPAPLMAIGMYSGYCGTLMTPMAANFNIVPAALLDLDDKY
QVIKVQIPTALALLTTNILLMYFIVFD