Protein Info for Sama_0015 in Shewanella amazonensis SB2B

Name: recF
Annotation: recombination protein F (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 354 (354 residues), 343.3 bits, see alignment E=9.1e-107 PF13175: AAA_15" amino acids 1 to 107 (107 residues), 32.8 bits, see alignment E=1.5e-11 PF13514: AAA_27" amino acids 1 to 126 (126 residues), 27.6 bits, see alignment E=5.4e-10 PF02463: SMC_N" amino acids 3 to 336 (334 residues), 117.5 bits, see alignment E=1.5e-37 PF13476: AAA_23" amino acids 5 to 51 (47 residues), 44.3 bits, see alignment 8.8e-15

Best Hits

Swiss-Prot: 100% identical to RECF_SHEAM: DNA replication and repair protein RecF (recF) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 100% identity to saz:Sama_0015)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1H1 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Sama_0015 recombination protein F (RefSeq) (Shewanella amazonensis SB2B)
MSLSRLSIDAFRNIDSAQLAPGAGLNLIYGHNGSGKTSILEAIYFLGMGRSFRSHLSQRV
IQNDADCLTLFAVAEGQAGDSRIGLRRHRSGDTEVKIDGEKVKRLSQLAEALPIQVITPE
SFSLLFEGPSARRQFIDWGAFHASKQFHLAWMNTRRILKQRNQLLRDGASYEHIAFWDKE
LIRYALEVTAIRNDYVGSLNGVLKGIIGEFLPDVDIRVSFTRGWDSKTDFSELLQSQYAR
DLAIGHTVSGPHKADLRLRVGNLPAQDALSRGQLKLLVCALRIAQGKLLKQQIDKHSIYL
VDDLPSELDAKHRQLLLKELIDTGAQLFVTAIEPSAIVDSLPVPPDRMFHVQAGRVTQTK