Protein Info for Sama_0013 in Shewanella amazonensis SB2B

Name: dnaA
Annotation: chromosomal replication initiation protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF11638: DnaA_N" amino acids 4 to 64 (61 residues), 71.1 bits, see alignment E=1.5e-23 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 455 (450 residues), 622.6 bits, see alignment E=2.2e-191 PF00308: Bac_DnaA" amino acids 123 to 282 (160 residues), 244 bits, see alignment E=2.6e-76 PF01695: IstB_IS21" amino acids 158 to 260 (103 residues), 31.8 bits, see alignment E=3.1e-11 PF00004: AAA" amino acids 159 to 262 (104 residues), 27.8 bits, see alignment E=9.6e-10 PF22688: Hda_lid" amino acids 291 to 353 (63 residues), 34 bits, see alignment E=7e-12 PF08299: Bac_DnaA_C" amino acids 366 to 434 (69 residues), 110.1 bits, see alignment E=1.3e-35

Best Hits

Swiss-Prot: 100% identical to DNAA_SHEAM: Chromosomal replication initiator protein DnaA (dnaA) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to saz:Sama_0013)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1G9 at UniProt or InterPro

Protein Sequence (457 amino acids)

>Sama_0013 chromosomal replication initiation protein (RefSeq) (Shewanella amazonensis SB2B)
MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAEMEGDTLVLYAPNRFVLDWVRDKYINSIN
QFFTEQLGDNAPKLRFDIGSRPSAKPQAPAPAAVKAAAPQPKPGNSFVSQPEPAVSNHRS
NINPTYQFDNFVEGKSNQLGKAAALQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNGII
KNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALFIDDIQFFANKDRSQEEF
FHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKA
QESGINLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLLALQ
EKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVARPRQMAMALSKELTNQSLPEIGDAFG
GRDHTTVLHACRKIAQLREESHDIKEDYANLIRTLSS