Protein Info for Shew_3865 in Shewanella loihica PV-4

Name: trmE
Annotation: tRNA modification GTPase TrmE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF10396: TrmE_N" amino acids 5 to 119 (115 residues), 121.7 bits, see alignment E=3.9e-39 TIGR00450: tRNA modification GTPase TrmE" amino acids 10 to 453 (444 residues), 327.4 bits, see alignment E=1.7e-101 PF12631: MnmE_helical" amino acids 122 to 450 (329 residues), 209.1 bits, see alignment E=1.8e-65 TIGR00231: small GTP-binding protein domain" amino acids 215 to 367 (153 residues), 73.8 bits, see alignment E=1.4e-24 PF01926: MMR_HSR1" amino acids 217 to 314 (98 residues), 85.6 bits, see alignment E=5.4e-28 PF02421: FeoB_N" amino acids 217 to 306 (90 residues), 34.7 bits, see alignment E=2.6e-12

Best Hits

Swiss-Prot: 100% identical to MNME_SHELP: tRNA modification GTPase MnmE (mnmE) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 100% identity to slo:Shew_3865)

MetaCyc: 74% identical to 5-carboxymethylaminomethyluridine-tRNA synthase GTPase subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJT0 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Shew_3865 tRNA modification GTPase TrmE (RefSeq) (Shewanella loihica PV-4)
MTTDTIVAQATAPGRGGVGIIRVSGDKASDVAMAVLGHLPKVRYADYCDFKAADGAVIDQ
GIALYFKGPNSFTGEDVLELQGHGGQVVLDMLIKRVMDVDGVRIAKPGEFSEQAFMNDKL
DLTQAEAIADLIDATSEQAAKSALNSLQGEFSTQVHELVDQVTNLRLYVEAAIDFPDEEV
DFLSDGKIAASLGKIITKLDSVQSSAKQGAIIREGMKVVIAGRPNAGKSSLLNALAGKES
AIVTEIAGTTRDVLREHIHLDGMPLHIIDTAGLRDTTDTVEQIGIERAWAEIETADQVLF
MVDGTTTDAVDPHDIWPDFIDRLPKNLGVTVVRNKADLTGESLDATDEQGHKVFRLSAKT
GSGVDELKAHLKSLMGYQSNLEGGFLARRRHLEALELASSHLALGQEQLEVYQAGELLAE
ELRMCQLALSEITGKFTSDDLLGKIFSSFCIGK