Protein Info for Shew_3858 in Shewanella loihica PV-4

Annotation: ubiquinone biosynthesis O-methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 19 to 247 (229 residues), 245.9 bits, see alignment E=1.6e-77 PF13489: Methyltransf_23" amino acids 68 to 219 (152 residues), 77.3 bits, see alignment E=5.3e-25 PF01209: Ubie_methyltran" amino acids 69 to 172 (104 residues), 20.6 bits, see alignment E=1.1e-07 PF13847: Methyltransf_31" amino acids 70 to 177 (108 residues), 56.6 bits, see alignment E=1.2e-18 PF02353: CMAS" amino acids 70 to 193 (124 residues), 31.8 bits, see alignment E=4.3e-11 PF05175: MTS" amino acids 73 to 170 (98 residues), 23.7 bits, see alignment E=1.4e-08 PF05401: NodS" amino acids 73 to 171 (99 residues), 29 bits, see alignment E=4.3e-10 PF13649: Methyltransf_25" amino acids 75 to 166 (92 residues), 67.7 bits, see alignment E=5.6e-22 PF08242: Methyltransf_12" amino acids 75 to 167 (93 residues), 60.7 bits, see alignment E=8.5e-20 PF08241: Methyltransf_11" amino acids 75 to 169 (95 residues), 74.8 bits, see alignment E=3.2e-24

Best Hits

Swiss-Prot: 49% identical to UBIG_RHOS5: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 100% identity to slo:Shew_3858)

MetaCyc: 48% identical to 2-polyprenyl-6-hydroxyphenol methylase (Cereibacter sphaeroides)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; RXN-9233 [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJS3 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Shew_3858 ubiquinone biosynthesis O-methyltransferase (RefSeq) (Shewanella loihica PV-4)
MLDKSRLSRFKTQIDSQTEIAKFDALAKEWRDPHGKFKHVLSFNQTRLTAIEDQIASHFG
RDLTQDIPFDGLSLLDIGCGVGLLCEPLASQGARVTGIDASEHNITLAHRHANSWSIPIE
YRHCLAGDLPREQPQYDVILNTEVIEHVEDQAALVASCCDLLKPGGLMVMATLNRTLRSY
LIGIIGAEYIMRYLPTGTHDWHHFVTPQELDEMLTPHGLSTKGVEGMAFNPFTRRWKITS
NSAVNYLLYASKPIPGVLEA