Protein Info for Shew_3854 in Shewanella loihica PV-4

Annotation: cobyrinic acid a,c-diamide synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF10609: ParA" amino acids 3 to 44 (42 residues), 35 bits, see alignment 3.7e-12 PF13614: AAA_31" amino acids 3 to 178 (176 residues), 216 bits, see alignment E=1.3e-67 PF09140: MipZ" amino acids 4 to 153 (150 residues), 49 bits, see alignment E=1.8e-16 PF06564: CBP_BcsQ" amino acids 4 to 246 (243 residues), 41.4 bits, see alignment E=4.3e-14 PF01656: CbiA" amino acids 5 to 228 (224 residues), 99.2 bits, see alignment E=5.9e-32 PF00142: Fer4_NifH" amino acids 10 to 253 (244 residues), 41 bits, see alignment E=5.8e-14 PF02374: ArsA_ATPase" amino acids 10 to 43 (34 residues), 26.3 bits, see alignment 1.5e-09

Best Hits

Swiss-Prot: 65% identical to Y002_PSEPK: Uncharacterized protein PP_0002 (PP_0002) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 100% identity to slo:Shew_3854)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJR9 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Shew_3854 cobyrinic acid a,c-diamide synthase (RefSeq) (Shewanella loihica PV-4)
MGKVIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYSVENTA
YELLVEEKSVEEVVYRDTAGKYDLIAGNGDVTAAEIKLMEFFAREIRLRNALAPVKDYYD
FIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALMDTISKLAAMVNPGLSIEG
ILRTMYDPRNRLANDVSDQLKQHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAK
AYLALAGEIIRRAEQHSQLEQA