Protein Info for Shew_3853 in Shewanella loihica PV-4

Annotation: parB-like partition protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 37 to 214 (178 residues), 198.9 bits, see alignment E=3.3e-63 PF02195: ParBc" amino acids 41 to 130 (90 residues), 108.8 bits, see alignment E=1.8e-35 PF17762: HTH_ParB" amino acids 180 to 230 (51 residues), 64.8 bits, see alignment 7.6e-22 PF23552: ParB_dimer" amino acids 243 to 292 (50 residues), 81 bits, see alignment 5e-27

Best Hits

Swiss-Prot: 56% identical to PARB_VIBCH: Probable chromosome-partitioning protein ParB (parB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 100% identity to slo:Shew_3853)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJR8 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Shew_3853 parB-like partition protein (RefSeq) (Shewanella loihica PV-4)
MTPKKRGLGKGLDALLSTSHAAARQAPMQEAEPNNNEELKMIALDLLQPGKYQPRKDMSP
EALEELAESIKTQGIIQPIVVRKVSDKGYEIIAGERRWRASQLAKLDKVPCIVKQVPDEA
AGVIALIENIQREDLNAMEEAIALERLIKEFELTHQQTADAVGKSRTTVSNLLRLNGLEE
PVKRMLEYGDIDMGHARALLALPGDEQTNLARTVIAKELTVRETERLVNKTLNPPEIVDK
PAKDQDVARLESQLIEKLGAKVSISHNKKGKGKMVINYQNLAELDGIIEKIR