Protein Info for Shew_3849 in Shewanella loihica PV-4

Annotation: F0F1 ATP synthase subunit B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details PF00430: ATP-synt_B" amino acids 6 to 137 (132 residues), 130.5 bits, see alignment E=2.2e-42 TIGR01144: ATP synthase F0, B subunit" amino acids 10 to 156 (147 residues), 190.4 bits, see alignment E=7.7e-61

Best Hits

Swiss-Prot: 100% identical to ATPF_SHELP: ATP synthase subunit b (atpF) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 100% identity to slo:Shew_3849)

MetaCyc: 72% identical to ATP synthase Fo complex subunit b (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase F0 sector subunit b (EC 3.6.3.14)" (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJR4 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Shew_3849 F0F1 ATP synthase subunit B (RefSeq) (Shewanella loihica PV-4)
MNINVTLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAK
ATDQLKEAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGKAEIEAERNRVKEDL
RKQVAALAIAGAEKILERSIDEAAHSDIVNKLVAEI