Protein Info for Shew_3822 in Shewanella loihica PV-4

Annotation: ATPase central domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF20720: nSTAND3" amino acids 110 to 212 (103 residues), 35.1 bits, see alignment E=3.3e-12 PF05496: RuvB_N" amino acids 112 to 238 (127 residues), 29.6 bits, see alignment E=1.6e-10 PF00004: AAA" amino acids 116 to 241 (126 residues), 123 bits, see alignment E=3.4e-39 PF00910: RNA_helicase" amino acids 116 to 201 (86 residues), 22.1 bits, see alignment E=5.6e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3822)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJP0 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Shew_3822 ATPase central domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MARADLVLNLVETGIKGDLPRFKKTAEAIAAEASARRQYHLADKLKNILTSTATVEGRHF
TFDSSLQNSFYEIRTQKTFDDLTLPEQVVSTFQEVVEEHARKDLLRSYNLEPRHKILLSG
PPGNGKTTLAEALANHLSVPFFTVKYEGIINRFLGETAQQIDKLFEHIKNQRCVLFFDEF
DAIGKEREDVNDNGEMKRVVNSLLKQIDLLPSHVVVIGATNHESMLDKAIWRRFQVQIEV
PSPTQRMATKWFEEFECRIGHSLGLAPSTMARRLMGLSFAELEEFALDVQRKYVLGLPES
EKNIKAITSNCLNVWSKRVKNK