Protein Info for Shew_3812 in Shewanella loihica PV-4

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 51 to 67 (17 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 44 to 474 (431 residues), 601.5 bits, see alignment E=5.1e-185 PF12801: Fer4_5" amino acids 99 to 129 (31 residues), 25.9 bits, see alignment (E = 4e-09) PF13746: Fer4_18" amino acids 222 to 327 (106 residues), 140.9 bits, see alignment E=9.9e-45 PF11614: FixG_C" amino acids 357 to 474 (118 residues), 113.8 bits, see alignment E=2.7e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3812)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJN0 at UniProt or InterPro

Protein Sequence (475 amino acids)

>Shew_3812 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MNAESNKKDYSKAERIKIHQPDENKSDRFNPRNRIYVRAIEGFWTQLRRRLGWVAMLFFL
ILPWIPWGDRQAVWFNLGEQKFHIFGLTIWPQDLTLLAALLMIAAFGLFFVTTYLGRVWC
GYTCPQTVWTFIFIWFEEKFEGARNKRMKLDQMPWSFNKVWRKTAKHLSWLLVSLLTAMT
FVSYFVPTTEVYADVFSGSASGAIYFWVTLFTVATYGNAGWMREIMCIHMCPYARFQSAM
FDKNTFIVGYDTKRGEDRGPRSRKADPKALGLGDCIDCDLCVQVCPTGIDIRNGLQYECI
NCGSCIDACDTTMERMGYDKGLIAYTTENKLEGVKEKVLRPKLLGYGAVLALMILVFIYA
TVTIAPVRIDIIRDRNQLFRENDQGLIENTFTLKILNKTEAKHEYQLSVEGLPDYQWYGP
QSVTIEGGEVLTLPVSVAVDPVGLSRAMTRVDFKVTTVLDGETVEATQESRFFSQ