Protein Info for Shew_3809 in Shewanella loihica PV-4

Annotation: protein of unknown function DUF610, YibQ (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04748: Polysacc_deac_2" amino acids 23 to 232 (210 residues), 255.6 bits, see alignment E=1.3e-80

Best Hits

Swiss-Prot: 35% identical to Y755_HAEIN: Uncharacterized protein HI_0755 (HI_0755) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K09798, hypothetical protein (inferred from 100% identity to slo:Shew_3809)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJM7 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Shew_3809 protein of unknown function DUF610, YibQ (RefSeq) (Shewanella loihica PV-4)
MRLLLLLAVLFTTPHCFAAQVSIIIDDIGYRQTDEAVLALPSDITLSVLPHTPLGERLAA
IAHDKGHEIMLHLPMQALNGKEMGPGGLTNQMSEQALKRAVDDAFKSVPYAKGVNNHMGS
LLTQLDAPMTWLMESLKQQDNYFVDSMTTRYSKASDAANRLGIPLLRRQLFLDNDVSPQG
LERQFNQLIQLANKEGQLIVIAHPYPETISFLKANLSRLSDEGIALVNTSRLLPYRLAQK
EPAASDKAHLR