Protein Info for Shew_3800 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 95 to 96 (2 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 259 to 275 (17 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 330 (313 residues), 37.5 bits, see alignment E=7e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3800)

Predicted SEED Role

"Major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJL8 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Shew_3800 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MSTSRGGFSLYAGVKMSVASSVFLLLPIYFDVISRQFAEPVLALTYVVTIELVGFSLASI
CCFFWQRMNFISERGVFLALALAHLGSALCSAVEWFVVLRFAAGFFAGILIVRCFDTLSH
DKLPDAAFGRAIAMQMLYSGLLFLLYPQLRLQGGFDGLLVLVAGFCLLMVLLPVDTRAQQ
MPKIKGVKTGKVFLYTALFAILMIMLANVGAWSMLSVVATRIGISEIDQGVILATGTLFS
LLGAVSASLLAKYGNRQRVITFGVLGQSIAIVLLFSTRDPLVYFVAVSCFMFMWNFLLPF
FMGVISEADPEGHAIRLAVAAQSIGAALAPAVLLKEWVLFELVIFLLITLLLIMPAIYNN
SRLKQQ