Protein Info for Shew_3797 in Shewanella loihica PV-4

Annotation: RND family efflux transporter MFP subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 35 to 367 (333 residues), 263.2 bits, see alignment E=1.4e-82 PF25917: BSH_RND" amino acids 60 to 190 (131 residues), 51.3 bits, see alignment E=1.7e-17 PF25944: Beta-barrel_RND" amino acids 206 to 288 (83 residues), 49 bits, see alignment E=1.4e-16 PF25954: Beta-barrel_RND_2" amino acids 247 to 291 (45 residues), 23.6 bits, see alignment 9.8e-09 PF25967: RND-MFP_C" amino acids 298 to 356 (59 residues), 61.7 bits, see alignment E=1e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3797)

Predicted SEED Role

"Membrane-fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJL5 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Shew_3797 RND family efflux transporter MFP subunit (RefSeq) (Shewanella loihica PV-4)
MGTSAKIIAISLPILLAACSQQAEVDGEFTEQPKVTVQVMQPQLIQLTEQFMGKTQAVDQ
VEILPKISGYLISQVYTDGAHVKKGDLLFEIDPKPFQAEVARLEANLAQKTAQMMLQAKK
HEKAQALLTQDALSSLEVEQIEAELLGMKAEVQSAKAELNYAQLDLENTHIYAPFNGIMS
DSRVSVGALVGPDAEPLTTLVSSDAMHVDIKLDEKQYLNDLQKRVQAGEEIASPEMALTL
ANGTLYNHKGEVDFIDNHVDSRSGSIRFRVTFPNPEGLLVPGQFVSVSSREQVAQQQLVV
PQAVVQEDQGGRYVLTVNQDNVVEARYVKLGLRQANTWIVQDGLQAGERVILSGLQSVRA
GVEVDVQQPVALAKKG