Protein Info for Shew_3790 in Shewanella loihica PV-4

Annotation: response regulator receiver modulated diguanylate cyclase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 94.5 bits, see alignment E=4.8e-31 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 129 to 287 (159 residues), 159 bits, see alignment E=4.5e-51 PF00990: GGDEF" amino acids 133 to 284 (152 residues), 149.1 bits, see alignment E=9.9e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3790)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJK8 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Shew_3790 response regulator receiver modulated diguanylate cyclase (RefSeq) (Shewanella loihica PV-4)
MEEQSVVLVVDDVKTNVLIMRQCLKEMFQVWTADSGEECLRVAKQKPDIILLDVLMPGMD
GYQVCRQLKADPETAEIPIIFVTAKDSDDDEQKGLEIGAVDYITKPIRPAIVRARVSTHI
QLKQHSDKLKFMALHDQLTGLYNRHFLAERAAQSLSAMVRHQQELSIVMLDLDHFKKIND
FNGHHIGDLVLQAVAKLLQDCFRKEDVVARMGGEEFVILMECGLDIAREKTEDVRQQLAR
LNPMGLEVTGSFGVVTANPQNAELSHLLVLADEAVYKAKADGRNCVVCYQDGAYLTVEHD