Protein Info for Shew_3747 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 177 to 193 (17 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 292 to 319 (28 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 375 to 399 (25 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details amino acids 435 to 452 (18 residues), see Phobius details amino acids 464 to 484 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3747)

Predicted SEED Role

"FIG01056842: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJG5 at UniProt or InterPro

Protein Sequence (540 amino acids)

>Shew_3747 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MYYLVASCIALLLGPLFYRFFTTGTGLQKGLDGFIFVSLGGLVLIHILPELLEHGGFLSL
LFVVVGLWGPTLSERLFHRYSEVTHNLTLTLGIGGLLLHTLTDGGAMVLAQQDGNSSLLA
LGVILHRLPVGLAIWWLLKPQVGSRWASIVLGGMMLLTGVGYFAGEQLLAQLSLDNTVYL
QAFVTGSILHVVLHQPHGHTIDDKQGKYEYQAGIGSLLGIALLFVLLAFDSGGHDHHEHS
HSSEQLLDWLLTLAPVLLLSYSLAAMRYLFGLSPHHERLSQRWLQRLAGPEALVITLLLL
GPSLAFIQLIGLTLVGILLTMTRVEPTDPHLGLPNSAWRFGFAHLVDRSAPWIILSLVLA
NLIGHPSVPLTSPLVQVGVLLLLLLPMRFCNLGGAVLALSLAYSGWTMEAVMLVLLAAPV
FNLAQLKLMDWTQRLALAGVIGLCLLGTHWLIPEWSRLLSLPETVNQLSLALAAMLFAAS
LLRLGPRKFMARIMLWKPKAHDHSHSRTNSHDHSHEPANGHEHKHSHEHKHTHHHEHGQH