Protein Info for Shew_3746 in Shewanella loihica PV-4

Annotation: multiple antibiotic resistance (MarC)-related protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 64 (26 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details PF01914: MarC" amino acids 3 to 192 (190 residues), 184.6 bits, see alignment E=1.6e-58

Best Hits

Swiss-Prot: 63% identical to YHGN_SHIFL: UPF0056 inner membrane protein YhgN (yhgN) from Shigella flexneri

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 100% identity to slo:Shew_3746)

Predicted SEED Role

"Multiple antibiotic resistance protein marC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJG4 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Shew_3746 multiple antibiotic resistance (MarC)-related protein (RefSeq) (Shewanella loihica PV-4)
MDIFSAAVMLFLIMDPLGNLPIFASILRHIEPKKRRKVLVRELIFALIIMLLFLFAGEAI
LSFLNLRSESVSIAGGIILFLIAIRMIFPQPGGVVGLAAGEEPFIVPMAIPLMAGPSVLA
ALILLAHTDSSRMMDWTIALFAAWVASAVILLFYKLFTKLLGEKGLTAVERLMGMVLVMI
SVQMFLDGVAQYIAHAS