Protein Info for Shew_3738 in Shewanella loihica PV-4

Annotation: sun protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01029: NusB
  • amino acids 3 to 125 (123 residues), 100.7 bits, E=2.2e-32
• TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase
  • amino acids 5 to 426 (422 residues), 463.1 bits, E=5.7e-143
• PF22458: RsmF-B_ferredox
  • amino acids 142 to 212 (71 residues), 83.6 bits, E=2.1e-27
• PF01189: Methyltr_RsmB-F
  • amino acids 235 to 424 (190 residues), 229 bits, E=1.1e-71
• PF13847: Methyltransf_31
  • amino acids 242 to 376 (135 residues), 34.2 bits, E=5e-12

Best Hits

Swiss-Prot: 79% identical to RSMB_SHEON: Ribosomal RNA small subunit methyltransferase B (rsmB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to slo:Shew_3738)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A3QJF6 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Shew_3738 sun protein (RefSeq) (Shewanella loihica PV-4)
MKNLRALAARVVFQVLEKGVSLSVALPEQQQRLTSGKDKALLAELCYGVMRHLPQLDKLV
SDCMSKPLKGKQRIVHQLLLVGCYQLYFTRIPGHAAISETAEACRQLKFEGLVKVVNGVL
RNLQRNQKPLPEDNETLAFNTPAWLIKRLKAAYPDSWQEMIAQSHQRPPMWLRNNQLSQT
REQYLTLLDEQEIAATPGASNDAILLESPKDVGMLPGFADGVASVQDGAAQWAASLLAPE
ANELILDACAAPGGKSCHLLESQPSIDLVAVDFDAKRLERVQQNLDRLSLKAKLVHGDAA
KIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQADIEELATLQSQILDHCWQWLK
PGGTLLYATCSILPQENAEQIAAFLARTQDATLIPIAQQQNSDDIGWQITPGQDNMDGFY
YARLVKG