Protein Info for Shew_3735 in Shewanella loihica PV-4

Annotation: peptidoglycan-binding LysM (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01476: LysM" amino acids 36 to 82 (47 residues), 42.1 bits, see alignment 3.4e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3735)

Predicted SEED Role

"Uncharacterized protein with LysM domain, COG1652" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJF3 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Shew_3735 peptidoglycan-binding LysM (RefSeq) (Shewanella loihica PV-4)
MDTPMKRLILLGLMIFSSSFVVADTLTLKSGHPDSYVVKKGDTLWDISAQFLKDPWRWPK
LWGANPQIANPHLIYPGDRLTLVFIDGEPRLVVKPHIRKSPEGRVLPKGGAIPAVDLSLI
QPYLVQNRVVDGEWFDEQPMVMGGESESKHHVTDDVIYIQGELTLGDKFGVYAKGRQFED
AESGDDLGLEVILTASGRVIESGPVSKVRLLSNMRETKAGYRVLPIEDDSLMSAYFMPKA
ATTPGKVLASEKDVREMGKLDVVYIDRGSQDGVETGHVFSIFRDGAEVVIDGDGKPVQPK
DRSTYEELLASISSDNATKMPDIYRGKLMVFKVFDRVSLGLILINEKPVRVHDKLLQPDT
LLASE