Protein Info for Shew_3727 in Shewanella loihica PV-4

Annotation: shikimate 5-dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00507: shikimate dehydrogenase
  • amino acids 34 to 300 (267 residues), 290.9 bits, E=4e-91
• PF08501: Shikimate_dh_N
  • amino acids 36 to 118 (83 residues), 84.1 bits, E=9.8e-28
• PF01488: Shikimate_DH
  • amino acids 142 to 221 (80 residues), 53.7 bits, E=3.6e-18
• PF18317: SDH_C
  • amino acids 267 to 297 (31 residues), 38.1 bits, see alignment (E = 1.6e-13)

Best Hits

Swiss-Prot: 66% identical to AROE_SHEHH: Shikimate dehydrogenase (NADP(+)) (aroE) from Shewanella halifaxensis (strain HAW-EB4)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 100% identity to slo:Shew_3727)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

See A3QJE5 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Shew_3727 shikimate 5-dehydrogenase (RefSeq) (Shewanella loihica PV-4)
MLAPFASPKKLSRLSAIESNRDHIPMTQQVQDRYAVFGHPIGHSKSPAIHQAFAKSTGES
LQYEAILAPLDGFAESLRAFFEHGGKGANVTLPFKEQAYALCDCLGDEAKLAGAVNTLTR
LADGRIKGDNTDGLGLVADLERHLGSLCGKSVLLIGAGGAARGAILPLLNAGIDSLTIHN
RTHSKAEQLAEAFKAYGQVKASTLDELTHSFDIVINSTSASLSGELPSLPKAIIAAHSVC
YDMMYGRELTAFNHWALDQGASQTIDGLGMLVGQAAKSFAIWRGVEPAVEPVLAKLRSEL
ASQA