Protein Info for Shew_3724 in Shewanella loihica PV-4

Annotation: diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 830 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 183 to 207 (25 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 261 to 388 (128 residues), 41.1 bits, see alignment E=1.8e-14 PF08447: PAS_3" amino acids 288 to 376 (89 residues), 80.5 bits, see alignment E=1.4e-26 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 392 to 557 (166 residues), 97.2 bits, see alignment E=8.4e-32 PF00990: GGDEF" amino acids 394 to 553 (160 residues), 124.4 bits, see alignment E=5.7e-40 PF00563: EAL" amino acids 575 to 808 (234 residues), 240.2 bits, see alignment E=3.2e-75

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3724)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJE2 at UniProt or InterPro

Protein Sequence (830 amino acids)

>Shew_3724 diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (RefSeq) (Shewanella loihica PV-4)
MLKFFSRPSLILFAPLVCVLLFAFFITSSYFVERQQRRDYVSASQVEHLSQGLMRMNHLV
AMAAKAQDFTRVEEELALLGSDIRLSVYTLIDRRGNIRFANHGVWRDSSAQLVIDGYESQ
AHENSVAEGRSRIYFNDKRQSIQAYYPITPQLSSLSVERPELIYLEYDMAPMLAASDETV
LVGLMRTGAIALATTLVLLGLFYYFVLSPIRYLSRQAAALGQRETDSRQKPIESPFIELH
SLEQNLRRFKDRFQQGAKQLKDSEQRWLFAVEVSRYGIWDWNLEDNSVFLSDRWKDMLGY
GPEDLVPELATWESRLHPEDKEGILKNLNAYLNGETEEFESVHRLRHQQGHYIWVLDRGM
TVEWNEKGKPLRMIGTLSDVTEDIRNQKAAMHQAKHDPLTDLANRRALMDALYQQQDESG
SCTALFMLDLDNFKVVNDALGHHGGDRLLIQIAARLSSYFSSNSLIARVAADEFVVLVKK
LPEDLLGAQRRAQALASQMRQLIARSFHISGHTFNLSASVGIAIIDPSETIPPEQQLKRV
NMALAQAKESGRDACVVYSSEMDKRAAQNLMIRTELVHAVTRHQLSLFYQPLLNAKGEIA
SVEALLRWHHPQHGAISPADFIPVAEGSALIVELGEWVLLEACRFIRGLQEQGIRPPMVS
INVSARQFHQDEFAPKLLVMLKDQGISPAHIELELTEHVLLTDLQQVRQTMTQLREAGVS
IAVDDFGTGYSSLSYLQELPLNRLKLDASFIRDMGNGDASASIVKAMIDMSHSLNLEFVA
EGVEIQSQFEQLKAYRCDLYQGYLFHRPMPGEELARLLVRLGDRPLLSSV