Protein Info for Shew_3712 in Shewanella loihica PV-4

Annotation: rhomboid family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 98 to 120 (23 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details PF12122: Rhomboid_N" amino acids 1 to 83 (83 residues), 93.1 bits, see alignment E=1.1e-30 TIGR04239: rhomboid family protease GlpG" amino acids 4 to 275 (272 residues), 366.1 bits, see alignment E=6.9e-114 PF01694: Rhomboid" amino acids 138 to 275 (138 residues), 106.5 bits, see alignment E=1.4e-34

Best Hits

KEGG orthology group: K02441, GlpG protein (inferred from 100% identity to slo:Shew_3712)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJD0 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Shew_3712 rhomboid family protein (RefSeq) (Shewanella loihica PV-4)
MLELGRLPNERAAQALIDYLKGQGIDCQLQHAEHGVILYVAREQDYAKARREYEHFVRNP
YDDKYLQASWENGSTGTKLDYGAPGLQLMTQFLSGAGPLTLIVMLSCTLIYLGFIFGFAN
PIFEALSFFAAVPGSDTSQIWRVFTPSLMHFSAMHIIFNLLWWWYLGGKIENKLGVTPLL
TLLLIAGTLPNLLQYAIGGPNFGGLSGVVYAVVGYTWIMGVRRPEKGIGLPPAYIGFMLV
WLVFGFTDMFGLSIANGAHVGGLMVGLAQGFIDSRRRV