Protein Info for Shew_3704 in Shewanella loihica PV-4

Annotation: dTDP-glucose 4,6-dehydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 13 to 351 (339 residues), 461 bits, see alignment E=9.8e-143 PF04321: RmlD_sub_bind" amino acids 13 to 285 (273 residues), 54 bits, see alignment E=4.8e-18 PF01370: Epimerase" amino acids 14 to 263 (250 residues), 214.9 bits, see alignment E=4.1e-67 PF02719: Polysacc_synt_2" amino acids 14 to 125 (112 residues), 46.5 bits, see alignment E=1e-15 PF01073: 3Beta_HSD" amino acids 15 to 248 (234 residues), 55.6 bits, see alignment E=1.5e-18 PF16363: GDP_Man_Dehyd" amino acids 15 to 338 (324 residues), 278.7 bits, see alignment E=3e-86 PF07993: NAD_binding_4" amino acids 84 to 200 (117 residues), 39.2 bits, see alignment E=1.7e-13

Best Hits

Swiss-Prot: 60% identical to RMLB_NEIMB: dTDP-glucose 4,6-dehydratase (rfbB1) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3704)

MetaCyc: 60% identical to dTDP-glucose 4,6-dehydratase 2 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJC2 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Shew_3704 dTDP-glucose 4,6-dehydratase (RefSeq) (Shewanella loihica PV-4)
MNSEQHHPLAGRNILITGGAGFIGSALIRHLIALGGCRVVNYDKLTYAGNLASLESIAQA
PNYHFIQADINDGDTLGGALRQYQIDLVIHLAAETHVDRSIEGPRAFIGTNIVGTFELLQ
QCLDYYRKLPIEIAARFRLHHVSTDEVFGDLGSDEAGYFSEQSPYAPSSPYSASKAAADH
LVRAWHRTYGLPVVLSNCSNNYGPYQYPEKLIPVTLLNALQGKLIPVYGDGKQIRDWLYV
DDHAHALCQVAARGELGESYNIGGMNEMTNLEVVSLICDLLNQKVTEKPCGISDFRQLIG
FVKDRPGHDTRYAIDASKLSRTLGWQPSESFASGLEKTVDWYLTHLDWCHQVAGQS