Protein Info for Shew_3688 in Shewanella loihica PV-4

Annotation: molybdenum cofactor biosynthesis protein A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 4 to 328 (325 residues), 371.6 bits, see alignment E=1.6e-115 PF04055: Radical_SAM" amino acids 18 to 178 (161 residues), 117.8 bits, see alignment E=9e-38 PF13353: Fer4_12" amino acids 22 to 122 (101 residues), 25.4 bits, see alignment E=2.4e-09 PF06463: Mob_synth_C" amino acids 184 to 311 (128 residues), 132 bits, see alignment E=1.9e-42

Best Hits

Swiss-Prot: 60% identical to MOAA_PSEE4: GTP 3',8-cyclase (moaA) from Pseudomonas entomophila (strain L48)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to slo:Shew_3688)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJA6 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Shew_3688 molybdenum cofactor biosynthesis protein A (RefSeq) (Shewanella loihica PV-4)
MSLIVDTFGRTVEYLRLSVTDRCDFRCVYCMSEDPCFLDREQVLSLEELAWIGQAFTELG
VKKIRLTGGEPLVRTDCDQLVKLLGQLPGLKELSMTTNGSRLSKFAGKMHEAGLSRLNIS
LDTLKPELFTQLTRNGNLERVIQGIDAAKAAGFNRIKINAVILRGQNDDEVLDLIEFCRE
RELDIAFIEEMPLGIIDERKKSRHCSSDEVKAIISQRYPLSVSDKRTGGPARYYTMPGSK
IHVGFISPHSNNFCHECNRVRVTVEGRLLLCLGNENSVDLKAIVRQYPGDIARLKQAILE
AIKLKPKEHHFGPEGETQILRFMNATGG