Protein Info for Shew_3687 in Shewanella loihica PV-4

Annotation: molybdopterin-guanine dinucleotide biosynthesis protein B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 PF03205: MobB" amino acids 13 to 146 (134 residues), 165.3 bits, see alignment E=1.4e-52 TIGR00176: molybdopterin-guanine dinucleotide biosynthesis protein B" amino acids 13 to 173 (161 residues), 136.7 bits, see alignment E=6.7e-44 PF03453: MoeA_N" amino acids 202 to 360 (159 residues), 142 bits, see alignment E=2.8e-45 TIGR00177: molybdenum cofactor synthesis domain" amino acids 370 to 506 (137 residues), 114.1 bits, see alignment E=5.3e-37 PF00994: MoCF_biosynth" amino acids 373 to 510 (138 residues), 112.7 bits, see alignment E=2.5e-36 PF03454: MoeA_C" amino acids 524 to 595 (72 residues), 64.3 bits, see alignment E=1.9e-21

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 100% identity to slo:Shew_3687)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobB / Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJA5 at UniProt or InterPro

Protein Sequence (599 amino acids)

>Shew_3687 molybdopterin-guanine dinucleotide biosynthesis protein B (RefSeq) (Shewanella loihica PV-4)
MSVPFNNPLPIPVLGFCAYSGTGKTTLLKKLIPELNRRGLRLAVVKHAHHNFDVDIPGKD
SYEMRKAGARQMLVASHVRWALMTEDPVEDAPELPHLLAQIEADKVDIVLVEGFKKLALP
KVELHRAAHGKPFIHPHDEHIQAIACCDDTELPSDLRRLDINDVGQIADFVIEYANNWRP
STPSLPLAPECGCELDTSKTLSVRQGIDKILSYVTPVSATEEVAIDDSTDRVLAQDAISP
VDVPQHTNSAMDGFAFAYSDPMLDSYTLVGDVMAGHSYQGTLNLGEAVRIMTGAPMPDGA
DTVQMKEMAEDSGDSVRFQGNIRLGQHVRQAGEDIAKEQTALSAGHRLKAAHQGMLASLG
FGKLPVYRRPKVAVFSTGDEVCQPGEPLKPNCIYDSNRFTIKSMVKQLGCEVIDLGILED
NESALVDALQGAAQQADVVISSGGVSVGDADFIKLALAKVGQINFWRINMRPGRPLAFGQ
IGDSLFFGLPGNPVAVMVSFMQFVQPALRKLAGELEWAPTLVPAIADCTLRSRTGRTEFT
RGVYHLGADGRLHVTSTGAQGSGMLSSMVKGNCLIVIAEKDEQLNVGDTVYIQPFADLL