Protein Info for Shew_3682 in Shewanella loihica PV-4

Annotation: two component, sigma54 specific, Fis family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF00072: Response_reg" amino acids 33 to 142 (110 residues), 88.5 bits, see alignment E=1.2e-28 PF00158: Sigma54_activat" amino acids 170 to 335 (166 residues), 225.8 bits, see alignment E=9.2e-71 PF14532: Sigma54_activ_2" amino acids 171 to 340 (170 residues), 61.1 bits, see alignment E=5e-20 PF07728: AAA_5" amino acids 194 to 312 (119 residues), 29.4 bits, see alignment E=2.5e-10 PF02954: HTH_8" amino acids 427 to 467 (41 residues), 34.5 bits, see alignment 4.6e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3682)

Predicted SEED Role

"Sigma-54 dependent response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJA0 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Shew_3682 two component, sigma54 specific, Fis family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MLESVQYESKCPKEDNMSQPNKEMKPLPSAVSVLIVDDEPGMRSFLKKALSKKFALVETA
GSVEDAEQLRSRCHFDLLIVDIRLPGRSGIEWDEALSDQERRSDIIFMTGYADMDVAIKA
LRAGASDFIMKPFHLEQMMKAVDRCIERRLLKRENLMLRREVSIGQSSTIIGSSDAMMEV
KHVIERVAPTNAVILIEGESGTGKELVARQLHLLSGRQGPFVPVNCGAIAPELLESELFG
HAAGSFTGAKGNREGLFSFASGGTIFLDEIGEMPLKMQTALLRVLEQRTIRPVGSEKEIN
IDVRVLAATNRKLADEVEAGNFRRDLFYRLNVLDIVIPPLRERPEDVVELTHHFTRLLAA
ELGVKEVVWSHEDMLKLQQHEWPGNIRELRNMIERCILLGKPPAEYWKQQPKSEATGELG
YPLDWSLKEVEKHHVTSVVDLHQGNKSAAARDLGVSRKTLDRKYKEWFELNHLEEE