Protein Info for Shew_3674 in Shewanella loihica PV-4

Annotation: cobalt transport protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 60 (17 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details PF02361: CbiQ" amino acids 24 to 208 (185 residues), 34.6 bits, see alignment E=7.8e-13

Best Hits

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 100% identity to slo:Shew_3674)

Predicted SEED Role

"Transmembrane component Dace_2068 of energizing module of predicted ECF transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJ92 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Shew_3674 cobalt transport protein (RefSeq) (Shewanella loihica PV-4)
MRAPGVRRAKRHFAVNDTRWCALAILLALGLSSCAFLLPQSWLHYLGLANLLLLIQGRYL
GGRLRGLLVIFTSQLAITSLLYLLLHGLERLPEGIIAVCRILMAMIPGWWLSVACSPQRI
GEVLSFCLPHKWAFVLAACFGILPYLGQETREIYQMQVMRGANIRLKSLWRPKHWRELIY
CVLYPLLIQLLKLSKQMATAARLRQFGRHPKPTHWPY