Protein Info for Shew_3654 in Shewanella loihica PV-4

Annotation: AbgT putative transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 transmembrane" amino acids 43 to 63 (21 residues), see Phobius details amino acids 99 to 99 (1 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 145 to 177 (33 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 406 to 429 (24 residues), see Phobius details amino acids 436 to 454 (19 residues), see Phobius details amino acids 466 to 485 (20 residues), see Phobius details amino acids 497 to 524 (28 residues), see Phobius details PF03806: ABG_transport" amino acids 27 to 535 (509 residues), 721.9 bits, see alignment E=3.2e-221 PF03606: DcuC" amino acids 146 to 501 (356 residues), 24.1 bits, see alignment E=1.3e-09

Best Hits

KEGG orthology group: K12942, aminobenzoyl-glutamate transport protein (inferred from 100% identity to slo:Shew_3654)

Predicted SEED Role

"Multidrug efflux pump component MtrF" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJ72 at UniProt or InterPro

Protein Sequence (537 amino acids)

>Shew_3654 AbgT putative transporter (RefSeq) (Shewanella loihica PV-4)
MSSNQEDGLVASQPPTPSTTKKGLFVRFLNLVEHLGNLLPHPITLFALFCAAVIVISGIA
GYFELTVNDPRPIGAAGRSEDGLIHVISLMNAEGLRMIVSNLVTNFTGFTPLGTVLVALL
GVGIADRSGLLSAAMRTLVMGASKRLVTLTIVFAGIVSNTAAELGYVVLIPMAALIFHSL
GRHPLAGLAAAFAGVSGGYSANLLLGTVDPLLSGITEAAAQMIDPDYLVGPEVNWYFMFA
STFVITILGALVTEKIVEPKLGKYDPSEASIDLHNQKMDGVTPLEIKGLKMAGLSILVLG
GILALSVVPENAPLRHPETGLVAGSPFLKGIVAFIFICFAIPGLVYGKVVGTMKRDKDVI
DAMSHSMSTMGMYIVLVFFASQFVAFFKWTNLGAVLAVAGADALNAIGLTGPLVFLLFIM
MCGFINLMLGSASAQWAVTAPIFVPMLMLVGYAPETIQAAYRIGDSVTNLITPMMSYFGL
ILAVASQYKKHLGIGTLVATMLPYSIVFFIGWTCFFFIWVFALGLPVGPGAATYYTP