Protein Info for Shew_3634 in Shewanella loihica PV-4

Annotation: RNA-binding S1 domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 787 PF09371: Tex_N" amino acids 2 to 76 (75 residues), 106 bits, see alignment E=2.7e-34 PF22706: Tex_central_region" amino acids 131 to 308 (178 residues), 223.2 bits, see alignment E=1e-69 PF16921: Tex_YqgF" amino acids 324 to 452 (129 residues), 176.9 bits, see alignment E=8.6e-56 PF14639: YqgF" amino acids 337 to 459 (123 residues), 40.8 bits, see alignment E=8.2e-14 PF14635: HHH_7" amino acids 466 to 557 (92 residues), 34.3 bits, see alignment E=1e-11 PF12836: HHH_3" amino acids 492 to 556 (65 residues), 101.3 bits, see alignment E=9.8e-33 PF17674: HHH_9" amino acids 562 to 631 (70 residues), 89.4 bits, see alignment E=8.8e-29 PF00575: S1" amino acids 650 to 721 (72 residues), 80.5 bits, see alignment E=4e-26

Best Hits

Swiss-Prot: 64% identical to YHGF_NEIMA: Uncharacterized protein NMA0194 (NMA0194) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K06959, uncharacterized protein (inferred from 100% identity to slo:Shew_3634)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJ52 at UniProt or InterPro

Protein Sequence (787 amino acids)

>Shew_3634 RNA-binding S1 domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MQNIAKIIAQELNVREQQVTATITLLDDGATVPFVARYRKEVTGGLDDTQLRTLYSRLGY
LRELNDRRQVILSSIQAQGKLTAELQAAIDQADSKTRLEDLYLPYKPKRRTKGQIAIEAG
IEPLVDRLLSDRQADIEALASEYLNAEAGLDEVKAVLDGARFILMERFAEDAELLQKVRQ
HLTQIAVLESHVVKGKEKEGAKFRDYFEHSEKLMNVPSHRALAMLRGRNEGVLSLSMNAD
PDSEAKSGSYCEVIIADHFNLKLSDSAVDQWLKLVVTSTWRIKIALQMETEFIAKLRERA
ETEAINVFARNLGDLLMAAPAGAKATLGLDPGLRTGVKVAIVNNTGKLMAHTTIFPHAPQ
NQWDKSIRTLANLVKMHKVELIAIGNGTASRETDKLAGELIAELKSELPTLTKIMVSEAG
ASVYSASELAAEEFPELDVSIRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQSQL
SQSLEAVVEDCVNGVGVDLNMASMPLLTQVAGLNKTLARNIVEYRDQNGQFTSRKQLLKV
PRLGPKAFEQAAGFLRIREGDNPLDASAVHPETYALVESIAKAQQQAVDALIGNTDLLKQ
IDAKAFVTEEFGLPTIEDILSELDKPGRDPRGEFKTAVFKEGVEEIKDLKVEMILEGVVT
NVTNFGAFVDIGVHQDGLVHISSLTDKFVSDPHTVVKAGDVVKVKVMEVDAERKRISLTM
RLDEKPGEKQMSHQGGKGQAKAGQGKGHQGKSPQGKSQAKGQYKQPKAPANAAMGNAFAD
AFAKLKK