Protein Info for Shew_3625 in Shewanella loihica PV-4

Annotation: sodium:dicarboxylate symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 179 to 206 (28 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 265 to 281 (17 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details PF00375: SDF" amino acids 14 to 403 (390 residues), 394.8 bits, see alignment E=2.3e-122

Best Hits

Swiss-Prot: 36% identical to GLTT_BACSU: Proton/sodium-glutamate symport protein (gltT) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3625)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJ43 at UniProt or InterPro

Protein Sequence (408 amino acids)

>Shew_3625 sodium:dicarboxylate symporter (RefSeq) (Shewanella loihica PV-4)
MKTKTSRLLGNIGVQVVIAMIIGAAVGFIMGEQASMFAPLGTLFIHLIKMLVIPLVLVSI
ISGAASLGDSPSAGKIGIGTFGFFIITSGVAVALALLLGSLFQPGNGVDFTAHSASGLMK
VTEEHGALPGVMDTFIGMIPTNVFESLTGGNILQILVFSIFFGIALTKVKGEGSKPILAA
LNTIVDAFVWMINCVMVIAPIGVFGLMADSVGTFGFDALEVVFKLFAVFVLGILLFGFLF
FPLLVQLFSNVSAKKFISVMKKPQVMALSTASSMATLPVNMETCEEELGVSKPTASFVLP
LGATINMSGNAIYYGLVAIFFAQMYGIDLSLGAYMAIIFTSTLGAIGQAGVPGPSFLVVA
VLLAAGIPIDGLPLLFALDRVFDMIRTSLNITGDAACAVILDKYTKAE