Protein Info for Shew_3619 in Shewanella loihica PV-4

Annotation: general secretion pathway protein D (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 707 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 33 to 625 (593 residues), 538.4 bits, see alignment E=1.1e-165 PF21305: type_II_gspD_N0" amino acids 34 to 103 (70 residues), 92.6 bits, see alignment E=1.7e-30 PF03958: Secretin_N" amino acids 130 to 191 (62 residues), 49.5 bits, see alignment 6.3e-17 amino acids 195 to 264 (70 residues), 59.4 bits, see alignment E=4.8e-20 amino acids 270 to 350 (81 residues), 59.1 bits, see alignment E=6.1e-20 PF00263: Secretin" amino acids 455 to 617 (163 residues), 168.7 bits, see alignment E=1.3e-53

Best Hits

Swiss-Prot: 56% identical to GSPD_VIBCH: Secretin GspD (epsD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 100% identity to slo:Shew_3619)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJ37 at UniProt or InterPro

Protein Sequence (707 amino acids)

>Shew_3619 general secretion pathway protein D (RefSeq) (Shewanella loihica PV-4)
MNNKKIRRNLIASVVMGASLLAPQVAWSEQYAANFKGTDIQEFINIVGKNLNRTIIVDPT
VRGKINVRSYDLLNDEQYYQFFLNVLQVYGYAVVEMDNNIIKVIKDKDAKTSAIRVADDS
TPGLGDEMVTRIVALYNTEAKQLAPLLRQLNDNAGGGNVVNYDPSNVLMISGRAAVVNKL
VEIVRRVDKQGDTEVQVVPLEYASAGEMVRIIDTLYRASANQSQLPGQAPKVVADERTNA
VIVSGDEKSRQRVVALIKKLDAEQATTGNTKVRYLRYAKAEDLVEVLTGFAEKLAKDQEG
GQAQGGRSKRRNEINIMAHPDTNALVISAEPDQMRTLESVINQLDIRRAQVLVEAIIVEV
AEGDDVGFGVQWATEAGGGTQFNNLGPTIGEIGAGIWAAQDEKASNSCTGSGDNLTCTDN
PDKKGDITLLAQALGKVNGMAWGVAMGDFGALIQAVSSDTKSNVLATPSITTLDNQEASF
IVGDEVPVLTGSQNSSNGNSNPFQTVERKEVGVKLKVVPQINEGTTVKLTIEQEVSGING
KTGVDVTFATRRLTTTVMADSGQIVVLGGLINEEVQESVQKVPFLGDIPILGHLFKSSSS
GKKKKNLMVFIKPTIIRDGVTMEGIAGRKYNYFRALQLEQQERGVNLMPNTSVPILEEWN
QAEYLPPEVNEVLQRYKDRKGLDTKMRETDPALKQINENKQQDKQDE