Protein Info for Shew_3618 in Shewanella loihica PV-4

Annotation: general secretory pathway protein E (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 TIGR02533: type II secretion system protein E" amino acids 38 to 520 (483 residues), 732.5 bits, see alignment E=1.1e-224 PF22341: GSPE_N1E" amino acids 38 to 101 (64 residues), 74.5 bits, see alignment E=5.9e-25 PF00437: T2SSE" amino acids 138 to 518 (381 residues), 527.6 bits, see alignment E=1.3e-162

Best Hits

Swiss-Prot: 71% identical to GSPE_VIBCH: Type II secretion system protein E (epsE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 100% identity to slo:Shew_3618)

Predicted SEED Role

"General secretion pathway protein E"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJ36 at UniProt or InterPro

Protein Sequence (523 amino acids)

>Shew_3618 general secretory pathway protein E (RefSeq) (Shewanella loihica PV-4)
MSDIQATQNEELAQVTSELGLASEAESDEVFHSSSRDRLPFAFAHRFELVLEKDDEAGLT
LYHTVNTPIDAMLEVRRYTGKELALAQLEPSVFEAKLTQVYQANSSEAQQLMEDIGNEMD
LFTLAEELPQTEDLLEGDDDAPIIKLINALLSEAIKEEASDIHIETYEKQLVVRFRVDGV
LKEVLKPNRKLSSLLVSRIKVMARLDIAEKRVPQDGRISLRIAGRAVDVRVSTMPSSHGE
RVVLRLLDKNAGNLDLKQLGMTDEIRHQFDELIRKPHGIILVTGPTGSGKSTTLYAGLTE
INAIDTNILTVEDPIEYELPGIGQTQVNTKVDMTFARGLRAILRQDPDVVMIGEIRDLET
AQIAVQASLTGHLVISTLHTNTASGAITRLQDMGVEPFLVSSSLLGVLAQRLIRTLCPSC
KTEHTPDLRERELLGISEDDPRTIYRATGCSACGHNGYRGRTGIHELLLVDDYVRELIHT
GRGELAIEKHIRKTVPSIRHDGMIKVLAGVTTLEEVLRVTREE