Protein Info for Shew_3601 in Shewanella loihica PV-4

Annotation: O-succinylbenzoate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21508: MenC_N
  • amino acids 5 to 113 (109 residues), 43.3 bits, E=3.4e-15
• TIGR01927: o-succinylbenzoate synthase
  • amino acids 9 to 326 (318 residues), 158.3 bits, E=1.4e-50
• PF13378: MR_MLE_C
  • amino acids 154 to 297 (144 residues), 48.9 bits, E=6.8e-17

Best Hits

KEGG orthology group: K02549, O-succinylbenzoate synthase [EC: 4.2.1.113] (inferred from 100% identity to slo:Shew_3601)

Predicted SEED Role

"O-succinylbenzoate synthase (EC 4.2.1.113)" (EC 4.2.1.113)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.113

Sequence Analysis Tools

See A3QJ19 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Shew_3601 O-succinylbenzoate synthase (RefSeq) (Shewanella loihica PV-4)
MILSQISLYRYQIPLDKLLPVGKQRIDNRQGLVLRASAVTEQDESVTAEVEIAPLSGQDV
DEQPLKGFSQESLSQVIDQLMPQLDELINQPVDELARLAQETQLPSLAFGLSLLHSRLSG
RLPAARRGARTIPLIYQAQDESPQALGARIDALENSTHAVKVKVGQTSMEQEVAMIHRIL
ARRPDLKLRLDANRSFSLEAAIDFLACLPLEAIEYIEEPCENPGDNTALYQALGVGFALD
ETLGSPGYRFTMTPGLSALIVKPMILGSLADLQALTQEAQEAGVRVILSASLEASLGINA
LRDLSEALTPDEVPGLDTLSAFSADLLVSTGKNRCLTLENLICLKQVSREAV