Protein Info for Shew_3600 in Shewanella loihica PV-4

Annotation: alpha/beta hydrolase fold (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12146: Hydrolase_4
  • amino acids 11 to 101 (91 residues), 27.6 bits, E=3.5e-10
• TIGR03695: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
  • amino acids 12 to 259 (248 residues), 254.8 bits, E=4.3e-80
• PF00561: Abhydrolase_1
  • amino acids 13 to 246 (234 residues), 79.9 bits, E=4.8e-26
• PF00975: Thioesterase
  • amino acids 15 to 161 (147 residues), 32.9 bits, E=1.6e-11
• PF12697: Abhydrolase_6
  • amino acids 15 to 256 (242 residues), 83.3 bits, E=8.1e-27

Best Hits

KEGG orthology group: K08680, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC: 4.2.99.20] (inferred from 100% identity to slo:Shew_3600)

Predicted SEED Role

"2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.2.99.20)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.20

Sequence Analysis Tools

See A3QJ18 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Shew_3600 alpha/beta hydrolase fold (RefSeq) (Shewanella loihica PV-4)
MLAYRCDGDSQRPVLVLLHGLLGDKDDWQAILPRLSRHFCCIALDLPGHGASPALEGDPD
SSGFQRVVTHILSTLDELKINRFHLLGYSLGGRIALHLAQHLAKRSPERLLSLHLESCHP
GLSDDAERAQRLEQDRRWQQKLLSLPITDFLALWYRQGVFASLSDAQRQRLIQKRAHNSP
EALASIYLPTSLGQQADLAQLPGELTIPWHYYVGLQDDKFLALASAWQARQGISLTKVPK
AGHNVHLAQPEAFCDALIANLRIQA