Protein Info for Shew_3596 in Shewanella loihica PV-4

Annotation: methyltransferase type 11 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF01135: PCMT" amino acids 42 to 128 (87 residues), 26 bits, see alignment E=1.9e-09 PF01209: Ubie_methyltran" amino acids 45 to 181 (137 residues), 30.5 bits, see alignment E=6.1e-11 PF13847: Methyltransf_31" amino acids 51 to 179 (129 residues), 43.7 bits, see alignment E=6.1e-15 PF13649: Methyltransf_25" amino acids 54 to 162 (109 residues), 34.2 bits, see alignment E=8.4e-12 PF08241: Methyltransf_11" amino acids 55 to 166 (112 residues), 32.3 bits, see alignment E=3.3e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3596)

Predicted SEED Role

"Mlr5283 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJ14 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Shew_3596 methyltransferase type 11 (RefSeq) (Shewanella loihica PV-4)
MLSMAGQVIAEDTAKAIEAAVHHEARLERDKARDGSRHPEAILNFFEVAPGQRVLDLFSG
GGYYSELLARVVGEQGSVLVHNNQAYLPFAKEDLAERHYQERLPNAEVIISEADELQLPA
ASFDRIFFILGFHDTYYHEPGWPAIDRERLLQQMFTSLKPGGIVAIIDHDAAPESDTDTA
HELHRLAKRHVVDAMEAAGFKLQGSLAVLENPEDKLTLSAFDEAVRGKTSRYVLMFVKPK
L