Protein Info for Shew_3571 in Shewanella loihica PV-4

Annotation: integral membrane sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 157 to 185 (29 residues), see Phobius details PF00672: HAMP" amino acids 181 to 235 (55 residues), 56.1 bits, see alignment 7.4e-19 PF00512: HisKA" amino acids 241 to 299 (59 residues), 46.4 bits, see alignment E=6.8e-16 PF02518: HATPase_c" amino acids 348 to 454 (107 residues), 80.5 bits, see alignment E=2.5e-26

Best Hits

KEGG orthology group: K07640, two-component system, OmpR family, sensor histidine kinase CpxA [EC: 2.7.13.3] (inferred from 100% identity to slo:Shew_3571)

Predicted SEED Role

"Copper sensory histidine kinase CpxA" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIY9 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Shew_3571 integral membrane sensor signal transduction histidine kinase (RefSeq) (Shewanella loihica PV-4)
MKISSLPNRIFIKLLLSFWLCSSLIIAIVGLLPLLQQNHDQAPIPPHLQGLLERVVERIQ
ESPELLTMKRDKHWHRLKEMGNKPVRFYVADEQGQLINNQRVSRGIRRFMLMADEAGHPI
SHQFKSELLFGPMPFEIEGKRYTLYGRLAEMHPRPWFFFFAENIALTLTLAILLSGLLCG
LLAWHLGKPLRALKQSAEAVASGDLGHRADASTTARKDEIGQLAQSFNAMADAIESMVNS
QQRLISDISHELRTPLTRLQLALALTRKKGQASTEIDRIGYEAEQLEAMIAELLELSRVK
LDIHEHKHRLSLAETLGQVLDDAEFEAEQQQKSLVIDIDDSLMLMLNPRPLARAIENLLR
NAIRYAEQEISISATAEPEQVILTIKDDGPGIEDEADLQAIFEPFYRPQSARERESGGWG
LGLAIAKAAIQAHQGQIVASNAAPHGLEITIRLPR