Protein Info for Shew_3568 in Shewanella loihica PV-4

Annotation: cation diffusion facilitator family transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 160 to 177 (18 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details PF01545: Cation_efflux" amino acids 16 to 208 (193 residues), 145.7 bits, see alignment E=1.6e-46 TIGR01297: cation diffusion facilitator family transporter" amino acids 16 to 288 (273 residues), 217.4 bits, see alignment E=1.2e-68 PF16916: ZT_dimer" amino acids 212 to 289 (78 residues), 80.9 bits, see alignment E=6.2e-27

Best Hits

Swiss-Prot: 51% identical to FIEF_KLEPN: Cation-efflux pump FieF (fieF) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3568)

MetaCyc: 49% identical to Zn2+/Fe2+/Cd2+ exporter (Escherichia coli K-12 substr. MG1655)
RXN0-6; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIY6 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Shew_3568 cation diffusion facilitator family transporter (RefSeq) (Shewanella loihica PV-4)
MTDTSQYDFWVKLASRAAVATALTLIVIKLAAWLYSGSASMLASLTDSFADALASIVNFI
AIRYAIVPADQDHRYGHGKAEPLAALAQSAFILGSALLLLLHGSDRLINPTPINHAMVGV
VVSVIAIVLTLALVLLQRRALAKTSSTIVEADALHYKSDLFLNSAVLMALVLSQFGWWWA
DGLFAILIALFIGQQAVDLGYRSAQSLLDRELDADTKLKIVQAIEKDPRINGFHDLRTRT
SGKTTFVQCHLELDGRLPLVEAHAIADAAEARVRSLFEHVEVLIHQDPV