Protein Info for Shew_3561 in Shewanella loihica PV-4

Annotation: nitrogen metabolism transcriptional regulator, NtrC, Fis family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 TIGR01818: nitrogen regulation protein NR(I)" amino acids 5 to 466 (462 residues), 765.8 bits, see alignment E=7.8e-235 PF00072: Response_reg" amino acids 5 to 111 (107 residues), 94.4 bits, see alignment E=1.5e-30 PF00158: Sigma54_activat" amino acids 139 to 305 (167 residues), 240.7 bits, see alignment E=2.1e-75 PF14532: Sigma54_activ_2" amino acids 140 to 310 (171 residues), 81.4 bits, see alignment E=2.3e-26 PF07724: AAA_2" amino acids 159 to 275 (117 residues), 29 bits, see alignment E=3.2e-10 PF07728: AAA_5" amino acids 163 to 281 (119 residues), 31.4 bits, see alignment E=5.3e-11 PF02954: HTH_8" amino acids 428 to 466 (39 residues), 53.6 bits, see alignment 4.4e-18

Best Hits

Swiss-Prot: 70% identical to NTRC_ECO57: DNA-binding transcriptional regulator NtrC (glnG) from Escherichia coli O157:H7

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 100% identity to slo:Shew_3561)

Predicted SEED Role

"Nitrogen regulation protein NtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIX9 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Shew_3561 nitrogen metabolism transcriptional regulator, NtrC, Fis family (RefSeq) (Shewanella loihica PV-4)
MTEKVWVLDDDSSIRWVVERALKGAKISCASFAAAESLWQALEQTQPQVIISDIRMPGTD
GLTLLDRLQLHYPHIPVIIMTAHSDLDSAVSAYQAGAFEYLPKPFDIDEAIGLVERALSH
AKEQSPKVISQPEVKAPEIIGEAPAMQEVFRAIGRLSRSSISVLINGQSGTGKELVAGAL
HKHSPRKDKPFIALNMAAIPKELIESELFGHEKGAFTGAANVRQGRFEQADGGTLFLDEI
GDMPLDVQTRLLRVLADGQFYRIGGHSPVQVDVRIIAATHQNLESLVAKGDFREDLFHRL
NVIRVHLPPLSQRREDIPQLARHFLATAAKEISVEPKILTKATADTLASLPWPGNVRQLE
NTCRWLMVMASGQEILPQDLPPELLTPSNSHDSSPQAGSGGWQEALTQWIDQRLSEGESD
LLTQIQPAFEKILLETALKHTKGHKQEAAKRLGWGRNTLTRKLKELEMD