Protein Info for Shew_3545 in Shewanella loihica PV-4

Name: rbn
Annotation: ribonuclease BN (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 166 to 183 (18 residues), see Phobius details amino acids 190 to 207 (18 residues), see Phobius details amino acids 226 to 252 (27 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 3 to 256 (254 residues), 276.1 bits, see alignment E=1.8e-86 PF03631: Virul_fac_BrkB" amino acids 10 to 257 (248 residues), 219.8 bits, see alignment E=2.6e-69

Best Hits

Swiss-Prot: 100% identical to Y3545_SHELP: UPF0761 membrane protein Shew_3545 (Shew_3545) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to slo:Shew_3545)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIW3 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Shew_3545 ribonuclease BN (RefSeq) (Shewanella loihica PV-4)
MIHLKQRITEDQINMRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIRSHIETFIYENF
IPSAGDSVQMYINEFVANASKGTAVGIGALVVVAILLISNIDKSLNGIWRTTEKRPMVVS
FSMYWMVLTLGPVLMGASLVATSYVVSLKLFSGTDLSGVVPLLVERLPMFFSVATFLLIY
MVVPNTKVKFFHALLGAIVAALLFELGKKGFALYLTEFPAYEAIYGALATIPILFMWVYL
SWIIVLIGAEITAAMPEYLDKRLMDLVNKELADDESEIHLDEHKR