Protein Info for Shew_3540 in Shewanella loihica PV-4

Annotation: NapC/NirT cytochrome c domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details PF03264: Cytochrom_NNT" amino acids 9 to 186 (178 residues), 187.5 bits, see alignment E=2.7e-59

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3540)

MetaCyc: 90% identical to quinol--cytochrome-c reductase CymA (Shewanella oneidensis MR-1)
RXN-15816 [EC: 7.1.1.8]

Predicted SEED Role

"Membrane anchored tetraheme cytochrome c, CymA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIV8 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Shew_3540 NapC/NirT cytochrome c domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MNWRALFKPSAKYSIFALLVVGIVVGVVGYFATQQTLHATSTDAFCMSCHSNHSLKDEVM
ASAHGGGRAGITVQCQDCHLPHGPVDYLIKKIIVSKDLYGFLTIDGFNTQEWLDENRKEQ
ADLALKYFRANDSANCQHCHTRIYENQPETMKKMAKRMHANNFKKEADKRKTCVDCHKGV
AHVYPKG