Protein Info for Shew_3540 in Shewanella loihica PV-4

Annotation: NapC/NirT cytochrome c domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03264: Cytochrom_NNT
  • amino acids 9 to 186 (178 residues), 187.5 bits, E=2.7e-59

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3540)

MetaCyc: 90% identical to quinol--cytochrome-c reductase CymA (Shewanella oneidensis MR-1)
RXN-15816 [EC: 7.1.1.8]

Predicted SEED Role

"Membrane anchored tetraheme cytochrome c, CymA"

MetaCyc Pathways

• sn-glycerol 3-phosphate anaerobic respiration (3/3 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• formate to nitrite electron transfer (1/3 steps found)
• Fe(II) oxidation (3/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.1.1.8

Sequence Analysis Tools

See A3QIV8 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Shew_3540 NapC/NirT cytochrome c domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MNWRALFKPSAKYSIFALLVVGIVVGVVGYFATQQTLHATSTDAFCMSCHSNHSLKDEVM
ASAHGGGRAGITVQCQDCHLPHGPVDYLIKKIIVSKDLYGFLTIDGFNTQEWLDENRKEQ
ADLALKYFRANDSANCQHCHTRIYENQPETMKKMAKRMHANNFKKEADKRKTCVDCHKGV
AHVYPKG